PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_135930_cwot.t1
Common NameSOVF_135930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 310aa    MW: 33919.7 Da    PI: 7.0786
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_135930_cwot.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.33.9e-17188222135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Sp_135930_cwot.t1 188 CLHCAAEKTPQWRTGPMGPKTLCNACGVRYKSGRL 222
                        99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.4E-791277IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.543182218IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-14182244No hitNo description
SMARTSM004012.0E-16182232IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.8E-14186220IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.68E-12187234No hitNo description
PROSITE patternPS003440188213IPR000679Zinc finger, GATA-type
PfamPF003207.3E-15188222IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEAPDFFVED LLDLSNGGGD EMITDTFFDT VTGNSMDSSS PTPASDSCNS SAVSCTPSFP  60
DSYFSGTDLC VPYDDMAELE WLSNFVEESF STDDLHKLQY IPTNPQQQHG GAARYGAIPP  120
TTTVPGKARS KRSRVPPCDW STRLLMVSAP SPATSSSESG ASPGQKKQPS LTKRRESGGP  180
ETGEVRRCLH CAAEKTPQWR TGPMGPKTLC NACGVRYKSG RLVAEYRPAA SPTFVSAKHS  240
NSHRKVMELR RQKECQRHQP PLHHQQPHHQ QQQYIGGGHG GGHHMMMAGG GGEDYFIHHH  300
LGGNDYRQMI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691426.11e-151PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-70GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0K9QVQ60.0A0A0K9QVQ6_SPIOL; Uncharacterized protein
STRINGVIT_09s0002g03750.t011e-103(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-68GATA transcription factor 9